PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_03298.1_g00003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 573aa    MW: 64345.9 Da    PI: 4.8591
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_03298.1_g00003.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM154.64.4e-48131392128
                      NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWka 85 
                              +pGfrFhPtdeelvv+yLk+k+ g+kl++ ++i  vd+ykv+P  Lp  + +k+++++w++F++r++ky++  r++r t++gyWka
  Rsa1.0_03298.1_g00003.1  13 APGFRFHPTDEELVVYYLKRKICGRKLRI-NAIGVVDVYKVDPTVLPglSVLKSGDRQWFYFTPRNRKYPNAARSSRGTATGYWKA 97 
                              69***************************.89***************644888899****************************** PP

                      NAM  86 tgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              tgkd+ ++  +++ vglkktLvfy+grap+ge+tdWvmhey++
  Rsa1.0_03298.1_g00003.1  98 TGKDRIIVY-NSRSVGLKKTLVFYRGRAPNGERTDWVMHEYTM 139
                              ********9.999****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100552.18512162IPR003441NAC domain
SuperFamilySSF1019417.06E-5512162IPR003441NAC domain
PfamPF023652.4E-2514138IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010200Biological Processresponse to chitin
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1900057Biological Processpositive regulation of leaf senescence
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 573 aa     Download sequence    Send to blast
MANSCLKGGR FSAPGFRFHP TDEELVVYYL KRKICGRKLR INAIGVVDVY KVDPTVLPGL  60
SVLKSGDRQW FYFTPRNRKY PNAARSSRGT ATGYWKATGK DRIIVYNSRS VGLKKTLVFY  120
RGRAPNGERT DWVMHEYTMD EEELGRCKNA KEYYALYKLY KKSGAGPKNG EEYGAPFQEE  180
EWLDDDDDDG EEEADDVAVP DDHVVRYENI PRVDNVLFCN PVNVRSDDFN KLLNEIPYAP  240
GLAPRQMNDV SGVMHVNSQE EMQSTLLNNS PGQFLAPWEV GMFLPSCQPN SIHSSYQSHV  300
RSADSFDGSE VKSAFKTSGV APFVFEKEDY IEMDDLLTPD QGAVSVEKPG QFLNPGEYEH  360
FNDYDQLFHD VSMSFDLEPV FQETYADLSS VSNFANDGRQ PFLYQQQFQD QTLETQVNSF  420
MDPNPNANQL VDDVWFKDAQ AALYDQPQSS SLAFASPSSG LMPESKNQEC QNGGETRSQF  480
SSAMWALLDS VPSTPASACE GPLNRTFVRM SSLSRIRFNG TSVTTSKVTV AKKGIGNKGF  540
LLLSVMGAMC AFFWVFIVAT VGVQGRHRYL NMS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A6e-441416819171NO APICAL MERISTEM PROTEIN
1ut4_B6e-441416819171NO APICAL MERISTEM PROTEIN
1ut7_A6e-441416819171NO APICAL MERISTEM PROTEIN
1ut7_B6e-441416819171NO APICAL MERISTEM PROTEIN
4dul_A6e-441416819171NAC domain-containing protein 19
4dul_B6e-441416819171NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00178DAPTransfer from AT1G34180Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013638215.10.0PREDICTED: NAC domain-containing protein 16-like
SwissprotA4FVP60.0NAC16_ARATH; NAC domain-containing protein 16
TrEMBLA0A078CAS50.0A0A078CAS5_BRANA; BnaC05g28020D protein
STRINGBra034439.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28122667
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34180.10.0NAC domain containing protein 16